Do's and Don'ts Of SEO

download Do's and Don'ts Of SEO

of 6

  • date post

    12-Jul-2015
  • Category

    Marketing

  • view

    88
  • download

    4

Embed Size (px)

Transcript of Do's and Don'ts Of SEO

  • SEO Checklist

    Buat judul laman yang unik, akurat. Lakukan:

    1. Buatisitagyangunikuntuksetiaplaman2. Pilihjudulyangmenyampaikantopikkontenlamandenganefektif3. JudullamanberandaAndadapatmenguraikannamasitusweb/bisnisdanmencakup

    sebagiankecilinformasipentingsepertilokasifisikbisnisataumungkinbeberapafokusataupenawaranutama.

    4. Judullamanlainnyadisesuaikandenganjudulkontendimasingmasinglaman.5. Gunakanjudulyangsingkatnamundeskriptif.Usahakanjudultersebuttidaklebihdari

    70karakter.Hindari:

    memilihjudulyangtidakberhubungandengankontenpadalaman menggunakanjudulyangstandarataukaburseperti"Untitled"atau"NewPage1" menggunakansatutagjudulpadasemualamanatausekumpulanbesarlamansitus

    Anda menggunakanjudulyangsangatpanjangyangtidakmembantupengguna menyertakankatakunciyangtidakdiperlukanpadatagjudulAnda

    Menggunakan meta tag "description" Lakukan:

    1. TulisdeskripsiyangakanmenginformasikandanmenarikperhatianpenggunajikamerekamelihatmetatagdeskripsiAndasebagaicuplikandalamhasilpenelusuran.

    2. Gunakandeskripsiunikuntuksetiaplaman3. Gunakandeskripsiyangsingkatnamundeskriptif.Usahakandeskripsitersebuttidak

    lebihdari155karakter.Hindari:

    menulismetatagdeskripsiyangtidakmempunyaihubungandengankontenlaman menggunakandeskripsiumumseperti"Iniadalahlamanweb"atau"Lamantentang

    uangkuno" mengisideskripsihanyadengankatakunci menyalindanmenempelseluruhkontendokumenkedalammetatagdeskripsi menggunakanmetatagdeskripsitunggaldisemualamansitusAndaataudisebagian

    besarlaman

  • Tingkatkan struktur URL Lakukan:

    1. GunakanURLdengankatakatayangrelevandengankontendanstruktursitus2. Buatstrukturdirektoriyangsederhana,mengaturkontenAndadenganbaikdan

    mempermudahpengunjungmengetahuilokasimerekadisitusAnda3. TetaplahfokusuntukmenggunakandanmengacupadasatuURLdalamstrukturdan

    pertautaninternallamanAnda4. Menyiapkanpengalihan301dariURLyangtidakdisukaikeURLdominan5. MenggunakanURLkanonisataumenggunakanelementautanrel="canonical"jika

    AndatidakdapatmengalihkanHindari:

    menggunakanURLpanjangdenganparameteryangtidakperludanIDsesi memilihnamalamanumumseperti"page1.html" menggunakankatakunciberlebihanseperti"uangkunouangkunouangkuno.htm" membuatsubdirektoribertingkatyangdalamseperti

    ".../dir1/dir2/dir3/dir4/dir5/dir6/page.html" menggunakannamadirektoriyangtidakberhubungandengankontendidalamnya memilikilamandarisubdomaindandirektoriakaryangmengakseskontenyangsama

    misal:"domain.com/page.htm"dan"sub.domain.com/page.htm" menggunakankapitalisasiURLyanganeh

    banyakpenggunamenyukaiURLdenganhurufkecildanmengingatnyadenganlebihbaik

    Buatlah situs agar lebih mudah untuk dinavigasi Lakukan:

    1. BuathierarkimengaliryangnaturaldansesederhanamungkinbagipenggunauntukmembukakontenumumdankontenspesifikyangmerekainginkandalamsitusAnda

    2. Banyakmenggunakantautanbertipeteksuntuknavigasi3. Menggunakanbreadcrumb4. IzinkankemungkinansebagianURLdihapus5. PersiapkanpetasitusHTMLuntukpengguna,petasitusXMLuntukmesintelusur6. Milikilaman404yangbergunauntukbalikkelamandasardanjugadapat

    menyediakantautankekontenpopulerataukontenterkaitpadasitusAndaHindari:

    membuatwebtautannavigasiyangrumit,mis.menautkansetiaplamanpadasitusAndake

    setiaplamanlainterlalubersemangatdalammembedahkontenAnda(sehinggamemerlukanduapuluhklik)

  • memilikinavigasiyangdidasarkansepenuhnyapadamenutarikturun,gambar,atauanimasi

    membiarkanlamanpetasitusHTMLAndamenjadiusangdengantautanyangrusak membuatpetasitusHTMLyangmencantumkanlamanlamanbegitusajatanpa

    mengaturnya, misalnyaberdasarkansubjek mengizinkanlaman404Andadiindeksdalammesintelusur(pastikanwebmaster

    AndadikonfigurasikanuntukmemberikodestatusHTTP404jikalamanyangtidakadadiminta)

    hanyamenyediakanpesankaburseperti"Tidakditemukan","404",atausamasekalitidakadalaman404

    menggunakanrancanganuntuklaman404AndayangtidakkonsistendenganbagiansitusAndayanglain

    Konten yang berkualitas Lakukan:

    1. Tulisteksyangmudahdibacadanditulisdenganbaik2. MengaturkontenAndasehinggapengunjungdapatmembedakankapansalahsatu

    kontendimulaidanlainnyadiakhiri3. Buatkontenyangunikdansegar4. BuatkontenyangdiutamakanuntukmenjawabkebutuhanpenggunaAnda,bukan

    mesintelusur5. Buatkontenyangseolaholahmenjawabpertanyaanpengguna

    Hindari:

    menulisteksyangtidakrapidenganbanyaksalahejadangramatika menyematkanteksdalamgambaruntukkontentekstual membanjirilamandengansejumlahbesartekstentangtopikyangberagamtanpa

    paragraf,subjudul,ataupemisahantampilan mengulangi(ataubahkanmenyalin)kontenyangadayanghanyamemberisedikitnilai

    tambahkepadapengguna memilikiversiduplikatatauhampirduplikatdarikontenAndadiseluruhsitusAnda memasukkankatakunciyangtidakpentingyangditujukanuntukmesintelusurtapi

    menggangguatautidakmasukakalbagipengguna memasangsekumpulanteksberisi"salahejayangseringdigunakanuntukmencapai

    lamanini"yangtidakbermanfaatbagipengguna menyembunyikanteksdaripengguna,tapimenampilkannyabagimesintelusur

    Teks tautan yang lebih baik Lakukan:

  • 1. Pilihteksyangdeskriptif2. Usahakanmembuatteksyangpendeknamundeskriptif,yangbiasanyamemiliki

    sedikitkataataufrasapendek3. Mempermudahpenggunamembedakanantarateksbiasadantekstautandaritautan

    AndaHindari:

    menulistekstautanyangumumseperti"laman","artikel",atau"klikdisini" menggunakanteksyangtidaksesuaitopikatautidakadakaitannyadengankonten

    darilamanyangtertaut menggunakanURLlamansebagaitekstautandalamkebanyakankasus meskipunterdapatpenggunaanyangjelassahatashalini,misalnya

    mempromosikanatau mereferensikanalamatsituswebbaru menulistekstautanyangpanjang,sepertikalimatyangpanjangatauparagrafpendek menggunakanCSSataupembuatgayateksyangmembuattautantampakseperti

    teksbiasa menggunakantekstautanyangpanjangataudipenuhiolehkatakunciyang

    berlebihanhanyauntukmesintelusur menciptakantautanyangtidakperluyangtidakmembantupenggunadalam

    menavigasisitus

    Optimalkan penggunaan gambar Lakukan:

    1. Gunakannamafiledanaltteksyangsingkatnamundeskriptif2. Berikanteksaltsaatmenggunakangambarsebagaitautan3. BerikanfilePetasitusGambar

    Hindari:

    menggunakannamafilegenerikseperti"image1.jpg","pic.gif","1.jpg"jikamungkin memasukkankatakuncikedalamteksaltataumenyalindanmenempelkanseluruh

    kalimat menulisteksaltyangterlalupanjangyangdapatdianggapspam hanyagunakantautangambaruntuknavigasisitusAnda

    Menggunakan tag heading sewajarnya Lakukan:

    1. Membuatsubheadingyangberisipoinpoinutamakonten2. Gunakantagheadingditempatyangmasukakal

  • Hindari:

    menempatkantekspadatagheadingyangtidakakanbergunadalammenentukanstrukturlaman

    menggunakantagheadingpadahaltaglainsepertidanmungkinlebihtepat

    bergantigantiukurantagheadingsecaratidakberaturan menggunakantagheadingsecaraberlebihandisepanjanglaman memasukkanseluruhtekslamanketagheading menggunakantagheadinghanyauntukgayadantidakmewakilistruktur

    Menggunakan robots.txt dengan efektif Lakukan:

    1. Blokirlamanyangtidakingindiindexdenganrobots.txt2. Gunakanmetodeyanglebihamanuntukkontenyangsensitif(enkripsiataudilindungi

    password)Hindari:

    memungkinkanlamanmiriphasilpenelusuranuntukdirayapipenggunatidaksukameninggalkansatulamanhasilpenelusurandanmembukalamanhasil

    penelusuranlainyangtidakmenambahkannilaiyangsignifikanbagimereka membiarkanterbentuknyaURLsebagaihasildarilayananproxyuntukdirayapi

    Mengunakan tautan rel="nofollow" Lakukan:

    1. Menyetelnilaiatribut"rel"daritautanmenjadi"nofollow"akanmemberitahuGooglebahwatautantertentupadasitusAndasebaiknyatidakdiikutiataumembagikanreputasilamanAndakelamanyangditautkan

    2. Menambahkan"nofollow"secaraotomatiskekolomkomentardanpapanpesan3. JikaAndatertarikuntukmengaktifkannofollowpadaseluruhtautanpadasebuah

    laman,Andadapatgunakan"nofollow"padametatagrobot

    Promosikan situs web Anda dengan cara yang benar Lakukan:

    1. JikaAndamenjalankanbisnislokal,menambahkaninformasinyakeGooglePlacesakanmembantuAndamenjangkaupelanggandiGoogleMapsdanpenelusuranweb

  • 2. Bagikansetiapberitaataupengumumanbarumelaluimediasosial,terutamaTwitterdanGoogle+

    3. Membuatakundisosialmedia,terutamaTwitterdanGoogle+Page